PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0049s0270.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 810aa    MW: 89041.4 Da    PI: 6.0553
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0049s0270.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.9e-096206571954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  SapurV1A.0049s0270.1.p 620 FEHflHPYPTDTDKHMLATQTGLSRYQVSNWFINARVR 657
                             554458******************************88 PP

2BELL71.91.1e-23481549472
                    BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             e q+ kakLl l+eeV +rYkqy++q+++ +s Fe vagl +a+ Y+s+  k +S +F+++k ai++q+
  SapurV1A.0049s0270.1.p 481 EYQQMKAKLLYLQEEVLRRYKQYHQQMEMAASFFESVAGLSAATQYISMTIKVVSGNFKSIKHAISDQL 549
                             67999*************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.6E-24384547IPR006563POX domain
PfamPF075263.1E-32390546IPR006563POX domain
SMARTSM003892.8E-8601665IPR001356Homeobox domain
CDDcd000864.47E-11601662No hitNo description
SuperFamilySSF466891.24E-16603667IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-27604665IPR009057Homeodomain-like
PfamPF059201.3E-17618657IPR008422Homeobox KN domain
PROSITE profilePS5007111.467620661IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
METKSFQPET HVAQRSRRDK LRSLTSVQHL EDFGNDLDQL AVDPVLTPDL VHVRHVRNGN  60
MLYGPTFLSS AMLSFATSSD VLSAQRGAMV DQELGPAHLT SPIAAENSSF TNMTHPVLSN  120
LNASPSASNG DAQGRGNWTK LGSEQGYGST VDFAGGSVAG ERNQNQNQKL MCAVEVLSNN  180
ARLTDITYTQ YLEPSYNEYR DNDLQSSLVD PSDEFSSQDN QKQFRERQFT THPLHQNTLQ  240
DVVTSGLVGR TQEIIPHPST ENLSSTLHFN DANAWIRRAS ENSRQWTGEL GLIIEESSQE  300
LMTNTQGLSL SLSSNQSSKV NETQFGEAYE SECLQSKKGL SKASYTCPLP RPSILSKGCG  360
KSLHDLPEDA TSILGNASPL GPFTGYATNL SSSRFLKPAQ ELMDELCGVK GLGLVRTSEL  420
PRRIGGASPP ASRDAVNEAD TGDKANDDTN LGASPLTSRR SNEEIGHCGG GSSSSESYMP  480
EYQQMKAKLL YLQEEVLRRY KQYHQQMEMA ASFFESVAGL SAATQYISMT IKVVSGNFKS  540
IKHAISDQLK HVTKALGENL FSPSPFGSST AGSLRYKDRS FQKSNSGGSN VGSLEHQEHI  600
WRPQRGLPER AVVILRAWLF EHFLHPYPTD TDKHMLATQT GLSRYQVSNW FINARVRLWK  660
PMVEEIHSLE TKGLLENNRS SGKNDGNSAE GASQPDGDHS KELGTSHVPG IQLECSRNIG  720
SSGGGRDELD AEEWDQEKRS RVGFQAPLRA DRSLMDFVLY QKPASENGDL GAVSLTLGLR  780
HGAENAQHQQ LQHSEENQLG RQFWRPDDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-16607664158Homeobox protein Meis1
4xrs_A3e-16607664158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002314290.20.0hypothetical protein POPTR_0009s01530g
TrEMBLB9HQC90.0B9HQC9_POPTR; Uncharacterized protein
STRINGPOPTR_0009s01530.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34813257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.13e-75BEL1-like homeodomain 8